Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat High affinity immunoglobulin epsilon receptor subunit beta(Ms4a2)

Recombinant Rat High affinity immunoglobulin epsilon receptor subunit beta(Ms4a2)

SKU:CSB-CF015013RA

Regular price £1,331.00 GBP
Regular price Sale price £1,331.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P13386

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDTENKSRADLALPNPQESPSAPDIELLEASPPAKALPEKPASPPPQQTWQSFLKKELEF LGVTQVLVGLICLCFGTVVCSTLQTSDFDDEVLLLYRAGYPFWGAVLFVLSGFLSIMSER KNTLYLVRGSLGANIVSSIAAGLGIAILILNLSNNSAYMNYCKDITEDDGCFVTSFITEL VLMLLFLTILAFCSAVLLIIYRIGQEFERSKVPDDRLYEELHVYSPIYSALEDTREASAP VVS

Protein Names:Recommended name: High affinity immunoglobulin epsilon receptor subunit beta Short name= FcERI Alternative name(s): Fc epsilon receptor I beta-chain IgE Fc receptor subunit beta Membrane-spanning 4-domains subfamily A member 2

Gene Names:Name:Ms4a2 Synonyms:Fce1b, Fcer1b

Expression Region:1-243

Sequence Info:Full length protein

View full details