Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

Recombinant Rat High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

SKU:CSB-CF008532RA

Regular price £1,310.00 GBP
Regular price Sale price £1,310.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P12371

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG

Protein Names:Recommended name: High affinity immunoglobulin epsilon receptor subunit alpha Alternative name(s): Fc-epsilon RI-alpha Short name= FcERI IgE Fc receptor subunit alpha

Gene Names:Name:Fcer1a Synonyms:Fce1a

Expression Region:24-245

Sequence Info:full length protein

View full details