Gene Bio Systems
Recombinant Rat High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)
Recombinant Rat High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)
SKU:CSB-CF008532RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P12371
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG
Protein Names:Recommended name: High affinity immunoglobulin epsilon receptor subunit alpha Alternative name(s): Fc-epsilon RI-alpha Short name= FcERI IgE Fc receptor subunit alpha
Gene Names:Name:Fcer1a Synonyms:Fce1a
Expression Region:24-245
Sequence Info:full length protein
