Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Group XVI phospholipase A1-A2(Pla2g16)

Recombinant Rat Group XVI phospholipase A1-A2(Pla2g16)

SKU:CSB-CF018089RA

Regular price £1,255.00 GBP
Regular price Sale price £1,255.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P53817

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPIPEPKPGDLIEIFRPMYSHWAIYVGDGYVIHLAPPSEIPGAGAASIMSALTDKAIVKKELLRDVAGKDKYQVNNKHDKEYTPLPLNKIIQRAEELVGQEVLYRLTSENCEHFVNELRYGVPRSDQVRDAVKVATVTGVGLAALGLIGVMLSRNKKQKQ

Protein Names:Recommended name: Group XVI phospholipase A1/A2 EC= 3.1.1.32 EC= 3.1.1.4 Alternative name(s): H-rev 107 protein HRAS-like suppressor 3

Gene Names:Name:Pla2g16 Synonyms:H-rev107, Hrasls3, Hrev107

Expression Region:1-160

Sequence Info:full length protein

View full details