Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Gamma-crystallin B(Crygb)

Recombinant Rat Gamma-crystallin B(Crygb)

SKU:CSB-YP006018RA

Regular price £756.00 GBP
Regular price Sale price £756.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Neuroscience

Uniprot ID: P10066

Gene Names: Crygb

Organism: Rattus norvegicus (Rat)

AA Sequence: GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY

Expression Region: 2-175aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 23 kDa

Alternative Name(s): Gamma-B-crystallin Gamma-crystallin 1-2

Relevance: Crystallins are the dominant structural components of the vertebrate eye lens.

Reference: "Nucleotide sequence of the rat gamma-crystallin gene region and comparison with an orthologous human region." den Dunnen J.T., van Neck J.W., Cremers F.P.M., Lubsen N.H., Schoenmakers J.G.G. Gene 78:201-213(1989)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details