Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Ephrin-B1(Efnb1)

Recombinant Rat Ephrin-B1(Efnb1)

SKU:CSB-CF007465RA

Regular price £1,371.00 GBP
Regular price Sale price £1,371.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P52796

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPQQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQQEKSGPGAGGSGSGDTDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGDSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

Protein Names:Recommended name: Ephrin-B1 Alternative name(s): ELK ligand Short name= ELK-L EPH-related receptor tyrosine kinase ligand 2 Short name= LERK-2

Gene Names:Name:Efnb1 Synonyms:Eplg2, Lerk2

Expression Region:25-345

Sequence Info:full length protein

View full details