Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat EGF, latrophilin and seven transmembrane domain-containing protein 1(Eltd1)

Recombinant Rat EGF, latrophilin and seven transmembrane domain-containing protein 1(Eltd1)

SKU:CSB-CF863671RA

Regular price £1,344.00 GBP
Regular price Sale price £1,344.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q9ESC1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:THFAILMSPSTSIEVKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNL CCSLFLAQLVFLVGININTNKLVCSIIAGLLHYFFLAAFAWMCIEGIYLYLIVVGLIYNK GFLHKNFYIFGYLSPAVVVGFSASLGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNL LAFGVIIYKVFRHTAGLKPEVSCYENIRSCARGALALLFLLGTTWTFGVLHVVHASVVTA YLFTVSNAFQGMFIFLFLCVLSRKIQEEYYRLFKNVPCCFECLR

Protein Names:Recommended name: EGF, latrophilin and seven transmembrane domain-containing protein 1 Alternative name(s): EGF-TM7-latrophilin-related protein Short name= ETL protein Cleaved into the following 2 chains: 1. EGF, latrophilin and seven t

Gene Names:Name:Eltd1 Synonyms:Etl

Expression Region:455-738

Sequence Info:full length protein

View full details