Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Cytochrome b561 domain-containing protein 2(Cyb561d2)

Recombinant Rat Cytochrome b561 domain-containing protein 2(Cyb561d2)

SKU:CSB-CF717531RA

Regular price £1,308.00 GBP
Regular price Sale price £1,308.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q641Y1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ALSVETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVLMSLAFSFLMT EALLMFSPESSLLRSLSRKVRARCHWVLQLLALLCALLGLGLVILHKEQLGKAHLATRHG QAGLLAVLWAGLQCSGGVGLLYPKLLPRWPLAKLKLYHATSGLVGYLLGSTSLLLGMCSL WFTANVTGGAWYLAVLCPILTSLVIMNQVSNAYLYRKRIQP

Protein Names:Recommended name: Cytochrome b561 domain-containing protein 2

Gene Names:Name:Cyb561d2

Expression Region:2-222

Sequence Info:full length protein

View full details