Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Corticosteroid 11-beta-dehydrogenase isozyme 1(Hsd11b1)

Recombinant Rat Corticosteroid 11-beta-dehydrogenase isozyme 1(Hsd11b1)

SKU:CSB-CF010763RA

Regular price £1,370.00 GBP
Regular price Sale price £1,370.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P16232

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKYLLPVLVLCLGYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMAFAERFVVEAGKLLGGLDMLILNHITQTTMSLFHDDIHSVRRSMEVNFLSYVVLSTAALPMLKQSNGSIAIISSMAGKMTQPLIASYSASKFALDGFFSTIRKEHLMTKVNVSITLCVLGFIDTETALKETSGIILSQAAPKEECALEIIKGTVLRKDEVYYDKSSWTPLLLGNPGRRIMEFLSLRSYNRDLFVSN

Protein Names:Recommended name: Corticosteroid 11-beta-dehydrogenase isozyme 1 EC= 1.1.1.146 Alternative name(s): 11-beta-hydroxysteroid dehydrogenase 1 Short name= 11-DH Short name= 11-beta-HSD1

Gene Names:Name:Hsd11b1 Synonyms:Hsd11

Expression Region:1-288

Sequence Info:full length protein

View full details