Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat BET1-like protein(Bet1l)

Recombinant Rat BET1-like protein(Bet1l)

SKU:CSB-CF002671RA

Regular price £1,212.00 GBP
Regular price Sale price £1,212.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O35152

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADWTRAQSSGAVEEIVDRENKRMADSLASKVTRLKSLALDIDRDTEDQNRYLDGMDSDFTSVTGLLTGSVKRFSTVARSGRDTRKLLCGMAVVLIVAFFILSYLFSRTRT

Protein Names:Recommended name: BET1-like protein Alternative name(s): Golgi SNARE with a size of 15 kDa Short name= GOS-15 Short name= GS15 Vesicle transport protein GOS15

Gene Names:Name:Bet1l Synonyms:Gs15

Expression Region:1-111

Sequence Info:full length protein

View full details