Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat ATP synthase lipid-binding protein, mitochondrial(Atp5g3)

Recombinant Rat ATP synthase lipid-binding protein, mitochondrial(Atp5g3)

SKU:CSB-CF741143RA

Regular price £1,159.00 GBP
Regular price Sale price £1,159.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q71S46

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMVAFLILFAM

Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATP synthase proteolipid P3 ATPase protein 9 ATPase subunit c

Gene Names:Name:Atp5g3

Expression Region:68-142

Sequence Info:full length protein

View full details