Gene Bio Systems
Recombinant Rat Acyl-CoA-binding protein(Dbi)
Recombinant Rat Acyl-CoA-binding protein(Dbi)
SKU:CSB-EP006519RA
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Transport
Uniprot ID:P11030
Gene Names:Dbi
Organism:Rattus norvegicus (Rat)
AA Sequence:SQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYGI
Expression Region:2-87aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:16.9 kDa
Alternative Name(s):Diazepam-binding inhibitor
Relevance:Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Reference:"Putative diazepam binding inhibitor peptide: cDNA clones from rat." Mocchetti I., Einstein R., Brosius J. Proc. Natl. Acad. Sci. U.S.A. 83:7221-7225(1986)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Involvement in disease:
Subcellular Location:Endoplasmic reticulum, Golgi apparatus
Protein Families:ACBP family
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Rn&CID=3285
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?rno:25045
STRING Database Link:https://string-db.org/network/10116.ENSRNOP00000066874
OMIM Database Link:
Lead Time Guidance:3-7 business days
