Gene Bio Systems
Recombinant Rat 6.8 kDa mitochondrial proteolipid(Mp68)
Recombinant Rat 6.8 kDa mitochondrial proteolipid(Mp68)
SKU:CSB-CF514247RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:D3Z9R8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLQSFIKKVWVPMKPYYTQVYQEIWVGVGLMSLIVYKIRSADKRSKALKGCSPAHAHGHH
Protein Names:Recommended name: 6.8 kDa mitochondrial proteolipid
Gene Names:Name:Mp68
Expression Region:1-60
Sequence Info:full length protein
