Skip to product information
1 of 1

GeneBio Systems

Recombinant Raphanus sativus Late embryogenesis abundant protein, partial

Recombinant Raphanus sativus Late embryogenesis abundant protein, partial

SKU:P21298

Regular price £735.00 GBP
Regular price Sale price £735.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P21298

Gene Names: N/A

Alternative Name(s): (Protein LEA)

Abbreviation: Recombinant Raphanus sativus Late embryogenesis abundant protein, partial

Organism: Raphanus sativus (Radish) (Raphanus raphanistrum var. sativus)

Source: E.coli

Expression Region: 1-48aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-KSI-tagged

Target Protein Sequence: MADLKDERGNPIHLTDAYGNPVQLSDEFGNPMHITGVASSAPQYKDSV

MW: 20.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: LEA protein are late embryogenesis abundant in higher plant seed embryos. There are two subsets of LEA proteins (5a, and 5b), the first ones are expressed when the cotyledon weight reach 80 mg and the second set are expressed above 100 mg. The function of those proteins is not known.

Reference: "Nucleotide sequence of a radish cDNA clone coding for a late embryogenesis abundant (LEA) protein." Raynal M., Gaubier P., Grellet F., Delseny M. Nucleic Acids Res. 18: 6132-6132(1990)

Function:

View full details