Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rabbit Tumor necrosis factor(TNF)

Recombinant Rabbit Tumor necrosis factor(TNF)

SKU:CSB-CF023955RB

Regular price £1,321.00 GBP
Regular price Sale price £1,321.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryctolagus cuniculus (Rabbit)

Uniprot NO.:P04924

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTESMIRDVELAEGPLPKKAGGPQGSKRCLCLSLFSFLLVAGATTLFCLLHFRVIGPQEEEQSPNNLHLVNPVAQMVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL

Protein Names:Recommended name: Tumor necrosis factor Alternative name(s): Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2 Short name= TNF-a Cleaved into the following 6 chains: 1. Tumor necrosis factor, membrane form Alternative name(s): N-terminal fragment Short name= NTF Intracellular domain 1 Short name= ICD1 Intracellular domain 2 Short name= ICD2 C-domain 1 C-domain 2 Tumor necrosis factor, soluble form

Gene Names:Name:TNF Synonyms:TNFA, TNFSF2

Expression Region:1-235

Sequence Info:full length protein

View full details