Recombinant Rabbit Leukocyte cell-derived chemotaxin 1(LECT1)

Recombinant Rabbit Leukocyte cell-derived chemotaxin 1(LECT1)

CSB-CF012854RB
Regular price
£868.00 GBP
Sale price
£868.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryctolagus cuniculus (Rabbit)

Uniprot NO.:O77770

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:EVVRKTVPTTTKRPHSGPRGNPGPARMRNDSRPSVQEDSEPFNPDNPYHQEGESMTFDPR LDHEGICCIECRRSYTHCQKICEPLGGYNPWPYNYQGCRSACRVVMPCSWWVARILGMV

Protein Names:Recommended name: Leukocyte cell-derived chemotaxin 1 Cleaved into the following 2 chains: 1. Chondrosurfactant protein Short name= 2. CH-SP 3. Chondromodulin-1 Alternative name(s): Chondromodulin-I Short name= ChM-I

Gene Names:Name:LECT1 Synonyms:CHMI

Expression Region:215-333

Sequence Info:Full length protein

Your list is ready to share