Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rabbit D(1A) dopamine receptor(DRD1)

Recombinant Rabbit D(1A) dopamine receptor(DRD1)

SKU:CSB-CF007178RB-GB

Regular price £1,250.00 GBP
Regular price Sale price £1,250.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryctolagus cuniculus (Rabbit)

Uniprot NO.:O02664

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:NTLLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIW VAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILIGVAWTLSVLISFIPV QLSWHKAKPTSPPDGNATSLDETVDNCDSSLSRTYSISSSLVNFYNPVAIMXVTYTRIHR

Protein Names:Recommended name: D(1A) dopamine receptor Alternative name(s): Dopamine D1 receptor

Gene Names:Name:DRD1

Expression Region:1-180

Sequence Info:Full length protein

View full details