Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pyrococcus furiosus UPF0290 protein PF0398(PF0398)

Recombinant Pyrococcus furiosus UPF0290 protein PF0398(PF0398)

SKU:CSB-CF851717FHW

Regular price £1,238.00 GBP
Regular price Sale price £1,238.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Uniprot NO.:Q8U3Q8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHPILEAFWYILPAYFANSSPVILGGGTPIDFGKTWRDGRRIFGDSKTWRGFLGGLTVGT LIGVIQQIIYPYYPSLSLAFKVSFLLALGALVGDLIGSFIKRRLNLPPGYPAVGLDQWGF LISALCFAYPVHTIPTGEVLLLLVVTPLIHWGTNVLAYKMKWKSVPW

Protein Names:Recommended name: UPF0290 protein PF0398

Gene Names:Ordered Locus Names:PF0398

Expression Region:1-167

Sequence Info:full length protein

View full details