Gene Bio Systems
Recombinant Putative membrane protein mmpS4 (ML2377)
Recombinant Putative membrane protein mmpS4 (ML2377)
SKU:CSB-CF347547MVN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium leprae
Uniprot NO.:P54880
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRESYADSNLGSSK PFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPWSLLMTTTLAAVMGNLVAQGN TDSIGCRIIVDGVVKAERVSNEVNAYTYCLVKSA
Protein Names:Recommended name: Putative membrane protein mmpS4
Gene Names:Ordered Locus Names:ML2377 ORF Names:u1740w
Expression Region:1-154
Sequence Info:full length protein
