Skip to product information
1 of 1

Gene Bio Systems

Recombinant Putative AgrB-like protein 2(CPE1561)

Recombinant Putative AgrB-like protein 2(CPE1561)

SKU:CSB-CF852120CMB

Regular price £1,278.00 GBP
Regular price Sale price £1,278.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium perfringens

Uniprot NO.:Q8XK42

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIENISKLIAEKVSSELNYDNERKEIIQYGTYALIQTLISIISVLILGLVFNIALEALIF LFTASILRKYSGGAHSESSNVCTLLGIIISICIGFLIKSSFFAKMNFELVVFIGIVIFVF GYFIVFKFAPVDTKNKPIKTEKKKKRMKKGSLKILTIYLFIEVLSIILYYNSGWSLAKPV MLSIIFGVAWQCMTLTYIGNILLKTIDSFTNKLL

Protein Names:Recommended name: Putative AgrB-like protein 2 EC= 3.4.-.-

Gene Names:Ordered Locus Names:CPE1561

Expression Region:1-214

Sequence Info:full length protein

View full details