Skip to product information
1 of 1

Gene Bio Systems

Recombinant Psychromonas ingrahamii Na(+)-translocating NADH-quinone reductase subunit D

Recombinant Psychromonas ingrahamii Na(+)-translocating NADH-quinone reductase subunit D

SKU:CSB-CF377233PZS

Regular price £1,298.00 GBP
Regular price Sale price £1,298.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Psychromonas ingrahamii (strain 37)

Uniprot NO.:A1SSY6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKSNEIKAVLTSPIISNNPITLQILGICSALAVTSKLENAVVMTVAVLFVTAFSNFFIS TIRNYIPNSVRIIVQMAIIASLVIVVDQFLRAYAFSISKQLSVYVGLIITNCIVMGRAEA FAMKNKPIASFMDGVGNGLGYGVILILVGAFRELFGSGSLYGFVILPLTSNGGWYQSNGL LLLAPSAFFIVGGIIWAVRTMRPDQVEPKE

Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit D Short name= Na(+)-NQR subunit D Short name= Na(+)-translocating NQR subunit D EC= 1.6.5.- Alternative name(s): NQR complex subunit D NQR-1 subunit D

Gene Names:Name:nqrD Ordered Locus Names:Ping_0749

Expression Region:1-210

Sequence Info:full length protein

View full details