Gene Bio Systems
Recombinant Psittacid herpesvirus 1 Glycoprotein N(UL49.5)
Recombinant Psittacid herpesvirus 1 Glycoprotein N(UL49.5)
SKU:CSB-CF764923PAAF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)
Uniprot NO.:Q6UDL9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AQLDAGILNPWGSAGHNDAVMPGMFANSESDERFYSPHCSSRGLPLVNESMASVIFFLSL AMVCVAIVAILYNCCFNSFKNSVINSRW
Protein Names:Recommended name: Glycoprotein N Short name= gN Alternative name(s): Protein UL49.5 Protein UL49A
Gene Names:Name:UL49.5
Expression Region:28-115
Sequence Info:full length protein
