Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas syringae pv. tomato Probable intracellular septation protein A(PSPTO_1809)

Recombinant Pseudomonas syringae pv. tomato Probable intracellular septation protein A(PSPTO_1809)

SKU:CSB-CF773309FGP

Regular price £1,267.00 GBP
Regular price Sale price £1,267.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas syringae pv. tomato (strain DC3000)

Uniprot NO.:Q885M2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQFIDFIPLLLFFIVYKTEPRAVDILGNSYTFGGIFSATAMLIISSVVVYGILYIKQRK LEKSQWLTLVACLVFGSLTLAFHSETFLKWKAPVVNWLFAVAFAGSHFIGDRPLIQRIMG HALTLPAAIWTRLNIAWIIFFLFCGAANLYVAFTYQEFWVDFKVFGSLGMTLIFLVGQGI YLSRHLHDTTPNTPKSED

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:PSPTO_1809

Expression Region:1-198

Sequence Info:full length protein

View full details