Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas syringae pv. syringae UPF0114 protein Psyr_4257(Psyr_4257)

Recombinant Pseudomonas syringae pv. syringae UPF0114 protein Psyr_4257(Psyr_4257)

SKU:CSB-CF709410PWE

Regular price £1,237.00 GBP
Regular price Sale price £1,237.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas syringae pv. syringae (strain B728a)

Uniprot NO.:Q4ZNI5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MERFFENAMYASRWLLAPIYFGLSLGLLALCLKFFQEIFHVIPNIFSLAEADLILVLLSL IDMALVGGLLVMVMISGYENFVSQLDIDEDKEKLNWLGTMDSSSLKMKVAASIVAISSIH LLRVFMDATNIKPEYLMWYVIIHMTFVISAFAMGYLDKVTKH

Protein Names:Recommended name: UPF0114 protein Psyr_4257

Gene Names:Ordered Locus Names:Psyr_4257

Expression Region:1-162

Sequence Info:full length protein

View full details