Gene Bio Systems
Recombinant Pseudomonas syringae pv. syringae UPF0114 protein Psyr_4257(Psyr_4257)
Recombinant Pseudomonas syringae pv. syringae UPF0114 protein Psyr_4257(Psyr_4257)
SKU:CSB-CF709410PWE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas syringae pv. syringae (strain B728a)
Uniprot NO.:Q4ZNI5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MERFFENAMYASRWLLAPIYFGLSLGLLALCLKFFQEIFHVIPNIFSLAEADLILVLLSL IDMALVGGLLVMVMISGYENFVSQLDIDEDKEKLNWLGTMDSSSLKMKVAASIVAISSIH LLRVFMDATNIKPEYLMWYVIIHMTFVISAFAMGYLDKVTKH
Protein Names:Recommended name: UPF0114 protein Psyr_4257
Gene Names:Ordered Locus Names:Psyr_4257
Expression Region:1-162
Sequence Info:full length protein
