Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas syringae pv. phaseolicola UPF0059 membrane protein PSPPH_3559(PSPPH_3559)

Recombinant Pseudomonas syringae pv. phaseolicola UPF0059 membrane protein PSPPH_3559(PSPPH_3559)

SKU:CSB-CF677577PAAT

Regular price £1,276.00 GBP
Regular price Sale price £1,276.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6)

Uniprot NO.:Q48FX8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPISLLFLALAMSTDAFAAALGKGASLHKPRFIEALRTGLIFGAIETITPVIGWGIGQV AARFAESWDHWIAFTLLLVLGLHMIYNGIKHDDDEEQEKPGQHSFWILAVTAFATSIDAL AVGVGLAFVDVNIVIAALAIGLATTVMVTIGVMLGRVLGTMVGKRAEIVGGIVLIIVGAT ILYEHLSAA

Protein Names:Recommended name: UPF0059 membrane protein PSPPH_3559

Gene Names:Ordered Locus Names:PSPPH_3559

Expression Region:1-189

Sequence Info:full length protein

View full details