Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas putida UPF0114 protein PP_0682(PP_0682)

Recombinant Pseudomonas putida UPF0114 protein PP_0682(PP_0682)

SKU:CSB-CF771842FGB

Regular price £1,233.00 GBP
Regular price Sale price £1,233.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas putida (strain KT2440)

Uniprot NO.:Q88Q16

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MERILENAMYASRWLLAPIYFGLSLGLLALALKFFQEVVHVLPNVFALSEADLILVILSL IDMSLVGGLLVMVMISGYENFVSQLDIDESKEKLNWLGKMDSSSLKMKVAASIVAISSIH LLRVFMDAQNISTDYLMWYVIIHMTFVVSAFCMGYLDKLTKH

Protein Names:Recommended name: UPF0114 protein PP_0682

Gene Names:Ordered Locus Names:PP_0682

Expression Region:1-162

Sequence Info:full length protein

View full details