Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas putida Probable intracellular septation protein A (Pput_1411)

Recombinant Pseudomonas putida Probable intracellular septation protein A (Pput_1411)

SKU:CSB-CF405382PZN

Regular price £1,265.00 GBP
Regular price Sale price £1,265.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas putida (strain F1 / ATCC 700007)

Uniprot NO.:A5W0A9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQFIDFIPLLLFFIVYKLDPRPMEVAGHHFEFGGIYSATAMLIISSLVVYGALFLRQRK LEKGQWLTLIACLVFGGLTLTFHSETFLKWKAPVVNWLFALGFAGSHFIGDRVLIKRIMG HALTLPDAIWTRLNLAWIAFFLFCGAANLFVAFTFQDFWVDFKVFGSLGMTVIFLVAQGV YLSRHLHDDPSTSKPKD

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Pput_1411

Expression Region:1-197

Sequence Info:full length protein

View full details