Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas putida Cobalamin synthase(cobS)

Recombinant Pseudomonas putida Cobalamin synthase(cobS)

SKU:CSB-CF773392FGB

Regular price £1,187.00 GBP
Regular price Sale price £1,187.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas putida (strain KT2440)

Uniprot NO.:Q88M93

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLPFWIALQFLSSLPVSLPGMPAPREVGRSLLYYPLVGLLFGLLLWLASHLLQGTPSPLH AALLLTLWVLLSGALHLDGLADSADAWLGGFGDRERTLRIMKDPRSGPIAVVTLVLVLLL KFCALWVLVGQGIGAQLLLAPLIGRAAMLGLFLCTPYVRPGGLGQALAEHMPRRAAGWVL LVCVLFCLFLGGWSVLLALAVFAWLRHLMCRRLGGTTGDTAGALLELLELAVVLGLALGL

Protein Names:Recommended name: Cobalamin synthase EC= 2.-.-.-

Gene Names:Name:cobS Ordered Locus Names:PP_1681

Expression Region:1-240

Sequence Info:full length protein

View full details