Gene Bio Systems
Recombinant Pseudomonas mendocina UPF0060 membrane protein Pmen_1247 (Pmen_1247)
Recombinant Pseudomonas mendocina UPF0060 membrane protein Pmen_1247 (Pmen_1247)
SKU:CSB-CF396713PZM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas mendocina (strain ymp)
Uniprot NO.:A4XRP6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSYLWFLLAAVFEIAGCYAFWMWLRLDRSAWWIAPGLLSLVLFALILTRVEASFAGRAY AAYGGVYIVASLAWLALIEKTRPMLSDWLGAALCLAGAAIILFAPRLHTS
Protein Names:Recommended name: UPF0060 membrane protein Pmen_1247
Gene Names:Ordered Locus Names:Pmen_1247
Expression Region:1-110
Sequence Info:full length protein
