Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa Type III export protein PscF(pscF)

Recombinant Pseudomonas aeruginosa Type III export protein PscF(pscF)

SKU:CSB-EP310982EZX

Regular price £690.00 GBP
Regular price Sale price £690.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P95434

Gene Names:pscF

Organism:Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

AA Sequence:AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI

Expression Region:2-85aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:16.6 kDa

Alternative Name(s):Pseudomonas secretion protein F

Relevance:Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages.

Reference:"Structure of the heterotrimeric complex that regulates type III secretion needle formation." Quinaud M., Ple S., Job V., Contreras-Martel C., Simorre J.P., Attree I., Dessen A. Proc. Natl. Acad. Sci. U.S.A. 104:7803-7808(2007)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:MxiH/PrgI/YscF family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?pae:PA1719

STRING Database Link:https://string-db.org/network/208964.PA1719

OMIM Database Link:

Lead Time Guidance:13-23 business days

View full details