Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa Type 4 prepilin-like proteins leader peptide-processing enzyme(pilD)

Recombinant Pseudomonas aeruginosa Type 4 prepilin-like proteins leader peptide-processing enzyme(pilD)

SKU:CSB-CF338456EZX

Regular price £1,344.00 GBP
Regular price Sale price £1,344.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Uniprot NO.:P22610

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPLLDYLASHPLAFVLCTILLGLLVGSFLNVVVHRLPKMMERNWKAEAREALGLEPEPKQ ATYNLVLPNSACPRCGHEIRPWENIPLVSYLALGGKCSSCKAAIGKRYPLVELATALLSG YVAWHFGFTWQAGAMLLLTWGLLAMSLIDADHQLLPDVLVLPLLWLGLIANHFGLFASLD DALFGAVFGYLSLWSVFWLFKLVTGKEGMGYGDFKLLAMLGAWGGWQILPLTILLSSLVG AILGVIMLRLRNAESGTPIPFGPYLAIAGWIALLWGDQITRTYLQFAGFK

Protein Names:Recommended name: Type 4 prepilin-like proteins leader peptide-processing enzyme Alternative name(s): Protein pilD Protein secretion protein XCPA Including the following 2 domains: Leader peptidase EC= 3.4.23.43 Alternative name

Gene Names:Name:pilD Synonyms:xcpA Ordered Locus Names:PA4528

Expression Region:1-290

Sequence Info:full length protein

View full details