Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudoalteromonas phage PM2 Protein P3(III)

Recombinant Pseudoalteromonas phage PM2 Protein P3(III)

SKU:CSB-CF896404PTQ

Regular price £1,183.00 GBP
Regular price Sale price £1,183.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudoalteromonas phage PM2 (Bacteriophage PM2)

Uniprot NO.:Q9XJR6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNTSVPTSVPTNQSVWGNVSTGLDALISGWARVEQIKAAKASTGQGRVEQAMTPELDNGA AVVVEAPKKAAQPSETLVFGVPQKTLLLGFGGLLVLGLVMRGNK

Protein Names:Recommended name: Protein P3 Alternative name(s): Protein III

Gene Names:Name:III

Expression Region:1-104

Sequence Info:full length protein

View full details