Recombinant Prochlorothrix hollandica Plastocyanin(petE)

SKU: CSB-EP344627PSD

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time:

Research Topic: Others

Uniprot ID: P50057

Gene Names: petE

Organism: Prochlorothrix hollandica

AA Sequence: LLLSAAPASAATVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE

Expression Region: 25-131aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 27 kDa

Alternative Name(s):

Relevance: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.

Reference: "NMR solution structure of plastocyanin from the photosynthetic prokaryote, Prochlorothrix hollandica."Babu C.R., Volkman B.F., Bullerjahn G.S.Biochemistry 38:4988-4995(1999).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.