Skip to product information
1 of 1

Gene Bio Systems

Recombinant Prochlorococcus marinus Photosystem II reaction center protein J(psbJ)

Recombinant Prochlorococcus marinus Photosystem II reaction center protein J(psbJ)

SKU:CSB-CF383056PZG

Regular price £1,175.00 GBP
Regular price Sale price £1,175.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Prochlorococcus marinus (strain MIT 9515)

Uniprot NO.:A2BUT1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKLKGPDGRIPDRLPDGRPAVAWERRWTEGTLPLWLVATAGGIAVIFVLGIFFYGSYQG VGAG

Protein Names:Recommended name: Photosystem II reaction center protein J Short name= PSII-J

Gene Names:Name:psbJ Ordered Locus Names:P9515_03331

Expression Region:1-64

Sequence Info:full length protein

View full details