Recombinant Prochlorococcus marinus NAD(P)H-quinone oxidoreductase subunit L

SKU: CSB-CF382632PZF

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Prochlorococcus marinus (strain MIT 9303)

Uniprot NO.:A2CAP6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFLQAVTSPISINSLMVLAAYVLLGGLYLIVVPLLLYSWMNRRWHCMGKFERLSAYGMVF LFFPGLILFAPFLNLRLNGQGEV

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit L EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L

Gene Names:Name:ndhL Ordered Locus Names:P9303_18141

Expression Region:1-83

Sequence Info:full length protein