Skip to product information
1 of 1

Gene Bio Systems

Recombinant Prochlorococcus marinus Cytochrome b6(petB)

Recombinant Prochlorococcus marinus Cytochrome b6(petB)

SKU:CSB-CF756295EYP

Regular price £1,281.00 GBP
Regular price Sale price £1,281.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Uniprot NO.:Q7VDK9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANSSPVYDWFQERLEIQDIADDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFY YKPTVTEAYNSVSYLMTDVSFGWLIRSVHRWSASMMVLMLILHVFRVYLTGGFKRPRELT WVTGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDFMVELLRGGESVGQ TTLTRFYSLHTFVLPWTLAIFMLMHFLMIRKQGISGPL

Protein Names:Recommended name: Cytochrome b6

Gene Names:Name:petB Ordered Locus Names:Pro_0367

Expression Region:1-218

Sequence Info:full length protein

View full details