Recombinant Probable signal peptidase complex subunit 1(CBG12804)

SKU: CSB-CF723435CXX

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis briggsae

Uniprot NO.:Q61CQ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDGMIAMLPAPLQQLSSHIDFQGQKVAERTYQVILTLAGIIGFFVGYSTQQLSYAMYTVM GAAVFTALIILPPWPFLFRKNPIVWQTPIEEQEASSSSDNEKKDKKKETKKTK

Protein Names:Recommended name: Probable signal peptidase complex subunit 1 EC= 3.4.-.- Alternative name(s): Microsomal signal peptidase 12 kDa subunit Short name= SPase 12 kDa subunit

Gene Names:ORF Names:CBG12804

Expression Region:1-113

Sequence Info:full length protein