Gene Bio Systems
Recombinant Probable disulfide formation protein C 2(bdbC2)
Recombinant Probable disulfide formation protein C 2(bdbC2)
SKU:CSB-CF818486BQE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus anthracis
Uniprot NO.:Q8KYH8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTIIRKYHIAIAWTIATSAMLISLIFSEWMKLPPCDLCWYQRMAMYPLVLILGIGMYRKD SNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVGVSCTENYLNLFGFISIPMLSFV GFLAIIILLYINQIKRQKNK
Protein Names:Recommended name: Probable disulfide formation protein C 2 Alternative name(s): Disulfide oxidoreductase C 2 Thiol-disulfide oxidoreductase C 2
Gene Names:Name:bdbC2 Ordered Locus Names:pXO1-139, BXA0208, GBAA_pXO1_0208
Expression Region:1-140
Sequence Info:full length protein
