Skip to product information
1 of 1

Gene Bio Systems

Recombinant Probable disulfide formation protein

Recombinant Probable disulfide formation protein

SKU:CSB-CF812726PJAF

Regular price £1,217.00 GBP
Regular price Sale price £1,217.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas resinovorans

Uniprot NO.:Q8GHM3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPQPSGMTWNLLLLTWLVALISTLSALFIGEVMGQAPCVLCWFQRAFMFPLTVILAIAC YRSDFTVWRYALPLTVIGAALAFVHTLLYAGLIPQPIQPCTATGPSCSGAGMTLFGVVPL PALALFAFIIIAILLIIIRRRTTP

Protein Names:Recommended name: Probable disulfide formation protein Alternative name(s): Disulfide oxidoreductase Thiol-disulfide oxidoreductase

Gene Names:

Expression Region:1-144

Sequence Info:full length protein

View full details