Skip to product information
1 of 1

Gene Bio Systems

Recombinant Preprotein translocase subunit SecE(secE)

Recombinant Preprotein translocase subunit SecE(secE)

SKU:CSB-CF314180EOD

Regular price £1,095.00 GBP
Regular price Sale price £1,095.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P0AG98

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVAL LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS FITGLRF

Protein Names:Recommended name: Preprotein translocase subunit SecE

Gene Names:Name:secE Ordered Locus Names:Z5554, ECs4904

Expression Region:1-127

Sequence Info:full length protein

View full details