Skip to product information
1 of 1

Gene Bio Systems

Recombinant Potato virus X Movement protein TGBp3 (ORF4)

Recombinant Potato virus X Movement protein TGBp3 (ORF4)

SKU:CSB-CF300775PRG

Regular price £1,176.00 GBP
Regular price Sale price £1,176.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Potato virus X (strain Xc) (PVX)

Uniprot NO.:P68833

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEAGAYLNAIIFVLVATIIAVISRGLTRTEPCTIRITGESITVHACHIDSETIKALANLKPLSLERLSFQ

Protein Names:Recommended name: Movement protein TGBp3 Alternative name(s): 7 kDa protein Triple gene block 3 protein Short name= TGBp3

Gene Names:ORF Names:ORF4

Expression Region:1-70

Sequence Info:full length protein

View full details