Skip to product information
1 of 1

Gene Bio Systems

Recombinant Potato virus M Movement protein TGB2 (ORF3)

Recombinant Potato virus M Movement protein TGB2 (ORF3)

SKU:CSB-CF323522PRA

Regular price £1,215.00 GBP
Regular price Sale price £1,215.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Potato virus M (strain Russian) (PVM)

Uniprot NO.:P17527

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPLTPPPDFTKVYLSAALGVSLALVVWLLIRSTLPVVGDRDHNLPHGGWYRDGTKSVFYN SPGRLNSIEARKAPLLGQPWAIVVLLVLLIWASHKLGRPNCRACAGSHT

Protein Names:Recommended name: Movement protein TGB2 Alternative name(s): 12 kDa protein Triple gene block 2 protein Short name= TGBp2

Gene Names:ORF Names:ORF3

Expression Region:1-109

Sequence Info:full length protein

View full details