Skip to product information
1 of 1

Gene Bio Systems

Recombinant Potato mop-top virus Movement protein TGB2

Recombinant Potato mop-top virus Movement protein TGB2

SKU:CSB-CF881269PQX

Regular price £1,091.00 GBP
Regular price Sale price £1,091.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Potato mop-top virus (isolate Potato/Sweden/Sw) (PMTV)

Uniprot NO.:Q9IV53

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVRNNEIGARPNKYWPVVAAVVAICLFGFLTVTNQKHATQSGDNIHKFANGGQYRDGSKS IKYNCNNPRAYNGSSSNITFSQLFLPVLLIGAALYAYLWFTRPDCSVTCRGDCCRSYGG

Protein Names:Recommended name: Movement protein TGB2 Alternative name(s): P14 Triple gene block 2 protein Short name= TGBp2

Gene Names:

Expression Region:1-119

Sequence Info:full length protein

View full details