Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pongo abelii Type-1 angiotensin II receptor-associated protein(AGTRAP)

Recombinant Pongo abelii Type-1 angiotensin II receptor-associated protein(AGTRAP)

SKU:CSB-CF735854PYX

Regular price £1,229.00 GBP
Regular price Sale price £1,229.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pongo abelii (Sumatran orangutan)

Uniprot NO.:Q5RER2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGG LLATIFLDIVHISIFYPRAGLTDTGRFGAGMAILSLLLKPLSCCFVYHMYRQRGGFLGSS QDRSAYQTIDSAEAPANAFAVPEGRGQDARGY

Protein Names:Recommended name: Type-1 angiotensin II receptor-associated protein Alternative name(s): AT1 receptor-associated protein

Gene Names:Name:AGTRAP

Expression Region:1-152

Sequence Info:full length protein

View full details