Gene Bio Systems
Recombinant Pongo abelii Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDHD)
Recombinant Pongo abelii Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDHD)
SKU:CSB-CF716169PYX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:Q5RC29
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAATLTLHGHWGLGQVVTDYVH GDASQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): CII-4 QPs3 Succinate dehydrogenase complex subunit D Succinate-ubiquinone oxidoreductase cyto
Gene Names:Name:SDHD
Expression Region:57-159
Sequence Info:full length protein
![Recombinant Pongo abelii Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDHD)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_ef81ff90-8206-4626-8ac2-94c1f41a657a.jpg?v=1659248090&width=1445)