Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pongo abelii High affinity copper uptake protein 1(SLC31A1)

Recombinant Pongo abelii High affinity copper uptake protein 1(SLC31A1)

SKU:CSB-CF722386PYX

Regular price £1,258.00 GBP
Regular price Sale price £1,258.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pongo abelii (Sumatran orangutan)

Uniprot NO.:Q5RAS6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSRGGGDSSMMMMPMTFYFGFKNVELLFSG LVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETH KTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKA VVVDITEHCH

Protein Names:Recommended name: High affinity copper uptake protein 1 Alternative name(s): Copper transporter 1 Solute carrier family 31 member 1

Gene Names:Name:SLC31A1

Expression Region:1-190

Sequence Info:full length protein

View full details