Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pongo abelii Cytochrome b5 type B(CYB5B)

Recombinant Pongo abelii Cytochrome b5 type B(CYB5B)

SKU:CSB-CF732778PYX

Regular price £1,211.00 GBP
Regular price Sale price £1,211.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pongo abelii (Sumatran orangutan)

Uniprot NO.:Q5RDJ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KGQEVETSVTYYRMEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDAS ESFEDVGHSSDAREMLKQYYIGDIHPSDLKPENGSKDPSKNDTCKSCWAYWILPIIGAVL LGFLYRYYTPESKSS

Protein Names:Recommended name: Cytochrome b5 type B Alternative name(s): Cytochrome b5 outer mitochondrial membrane isoform

Gene Names:Name:CYB5B Synonyms:CYB5M

Expression Region:12-146

Sequence Info:full length protein

View full details