Skip to product information
1 of 1

Gene Bio Systems

Recombinant Polaromonas naphthalenivorans Probable intracellular septation protein A (Pnap_1834)

Recombinant Polaromonas naphthalenivorans Probable intracellular septation protein A (Pnap_1834)

SKU:CSB-CF379368PYT

Regular price £1,280.00 GBP
Regular price Sale price £1,280.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Polaromonas naphthalenivorans (strain CJ2)

Uniprot NO.:A1VNB6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKILFDFLPIALFFGMFKYAEGHKDWAAGLATDWLGFMVSGGVVGPAEAPVLLATVVVIV ATLAQILWLKARGRKVDTMLWVSLALVTALGSATIYFHSESFIKWKPTVLYWVMGASLLV GELVFKKNGIKSLMGAQMSLPDAVWRKVNFSWVAFFAAMGCLNLWVAFNFPTSTWVNFKL FGGMGLMLVFVLAQAFFLNKHIKPDTTS

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Pnap_1834

Expression Region:1-208

Sequence Info:full length protein

View full details