Skip to product information
1 of 1

Gene Bio Systems

Recombinant Podospora anserina Signal peptidase complex catalytic subunit SEC11(SEC11)

Recombinant Podospora anserina Signal peptidase complex catalytic subunit SEC11(SEC11)

SKU:CSB-CF460004EXJ

Regular price £1,247.00 GBP
Regular price Sale price £1,247.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)

Uniprot NO.:B2B3T2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSALGNPRQAAAQLMNFGLILSTAFMMWKGLSVISDSPSPIVVVLSGSMEPAFQRGDLL LLWNRNLFTETSVGEVVVYNVRDKDIPIVHRVISKFGTGFVIPRQWWLFMGIYNNDSDDT KLYAPGQNYLVREDIIGRSVVGYMPFVGYVTIMLSEHPWMKTVMLGIMGLVVVLQRE

Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I

Gene Names:Name:SEC11 ORF Names:CDS Pa_6_7190

Expression Region:1-177

Sequence Info:full length protein

View full details