Skip to product information
1 of 1

Gene Bio Systems

Recombinant Podospora anserina Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

Recombinant Podospora anserina Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

SKU:CSB-CF769829EXJ

Regular price £1,287.00 GBP
Regular price Sale price £1,287.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)

Uniprot NO.:Q875C2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSNGPLSNRPLPSSFDSNDDFYNENGFQKVLRRLKEEPLVPIGCLLTVAAFTNAYRAMRR GDHAKVQKMFRARVAAQAFTVVAMVAGGMYYQADRHKQKELWKLRQQKDAEEKHQKWIRE LEARDAEEKALQERLDKRRKRAAERAGGTGTESVAAQARAALRESKAGKTETGEATSTEA NQADGGVLGSLGGWFGGSKKAPEDTTPALESKPEDPKN

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:AIM31 ORF Names:Pa_5_5310

Expression Region:1-218

Sequence Info:full length protein

View full details