Skip to product information
1 of 1

GeneBio Systems

Recombinant Plasmodium falciparum Merozoite surface protein 2 (MSP2), partial

Recombinant Plasmodium falciparum Merozoite surface protein 2 (MSP2), partial

SKU:P50498

Regular price £833.00 GBP
Regular price Sale price £833.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P50498

Gene Names: MSP2

Alternative Name(s): 45KDA merozoite surface antigen

Abbreviation: Recombinant Plasmodium falciparum MSP2 protein, partial

Organism: Plasmodium falciparum (isolate 3D7)

Source: Yeast

Expression Region: 109-246aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN

MW: 16.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May play a role in the merozoite attachment to the erythrocyte.

Reference: Structural diversity in the 45-kilodalton merozoite surface antigen of Plasmodium falciparum.Smythe J.A., Peterson M.G., Coppel R.L., Saul A.J., Kemp D.J., Anders R.F.Mol. Biochem. Parasitol. 39: 227-234(1990)

Function: May play a role in the merozoite attachment to the erythrocyte.

View full details